For quotations, please use our online quotation form, and you may also contact us by
service@kendallscientific.com
+1-888.733.6849 (Toll-free)
+1-617.299.7367 (Int’l))
+1-888.733.6849
Our customer service representatives are available 24 hours, Monday through Friday to assist you.| Introduction | Vascular endothelial growth factor is an important signaling protein involved in both vasculogenesis and angiogenesis. As its name implies, VEGF activity has been mostly studied on cells of the vascular endothelium, althoµgh it does have effects on a number of other cell types (e.g. stimulation monocyte/ macrophagemigration, neurons, cancer cells, kidney epithelial cells ).VEGF mediates increased vascular permeability, induces angiogenesis, vasculogenesis and endothelial cell growth, promotes cell migration, and inhibits apoptosis. In vitro, VEGF has been shown to stimulate endothelial cell mitogenesisand cell migration. VEGF is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor.Elevated levels of this protein are linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. |
| Synonyms | Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609. |
| Source | Sf9, Insect Cells. |
| Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | The protein was lyophilized from a solution containing 50mM acetic acid. |
| Solubility | The lyophilized VEGF121 should be reconstituted in 50mM acetic acid to a concentration not lower than 50 |
| Stability | Lyophilized Vascular Endothelial Growth Factor 121 althoµgh stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-121 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Amino Acid Sequence | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPR. |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Biological Activity | The ED50 for stimulation of 3H-thymidine incorporation and cell proliferation by human umbilical vein endothelial cells for VEGF121 has been determined to be in the range of 1-4 ng/ml. |
| Usage | NeoBiolab's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. |
N/A
N/A